Package: bacontrees 1.0.0
bacontrees: Bayesian Context Trees for Discrete Sequence Data
Models discrete sequential data using Bayesian Context Trees. Context trees, also known as Variable Length Markov Chains (VLMCs), are parsimonious Markov models where the order of dependence can vary with the observed past. Provides a generic 'R6' class structure that exposes the full tree for building custom algorithms, exact Bayesian inference via a bottom-up recursive algorithm (closed-form marginal likelihood, Maximum A Posteriori (MAP) tree, exact posterior probabilities, and exact sampling from the posterior), a frequentist estimator via the context algorithm with likelihood-ratio pruning, simulation utilities, and a Metropolis-Hastings sampler. See Paulichen and Freguglia (2026) <doi:10.48550/arXiv.2603.25806>.
Authors:
bacontrees_1.0.0.tar.gz
bacontrees_1.0.0.zip(r-4.7)bacontrees_1.0.0.zip(r-4.6)bacontrees_1.0.0.zip(r-4.5)
bacontrees_1.0.0.tgz(r-4.6-x86_64)bacontrees_1.0.0.tgz(r-4.6-arm64)bacontrees_1.0.0.tgz(r-4.5-x86_64)bacontrees_1.0.0.tgz(r-4.5-arm64)
bacontrees_1.0.0.tar.gz(r-4.7-arm64)bacontrees_1.0.0.tar.gz(r-4.7-x86_64)bacontrees_1.0.0.tar.gz(r-4.6-arm64)bacontrees_1.0.0.tar.gz(r-4.6-x86_64)
bacontrees_1.0.0.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
bacontrees/json (API)
| # Install 'bacontrees' in R: |
| install.packages('bacontrees', repos = c('https://freguglia.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/freguglia/bacontrees/issues
Last updated from:01e9bbbdc2. Checks:13 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-arm64 | OK | 606 | ||
| linux-devel-x86_64 | OK | 205 | ||
| source / vignettes | OK | 240 | ||
| linux-release-arm64 | OK | 188 | ||
| linux-release-x86_64 | OK | 187 | ||
| macos-release-arm64 | OK | 112 | ||
| macos-release-x86_64 | OK | 277 | ||
| macos-oldrel-arm64 | OK | 163 | ||
| macos-oldrel-x86_64 | OK | 288 | ||
| windows-devel | OK | 158 | ||
| windows-release | OK | 173 | ||
| windows-oldrel | OK | 144 | ||
| wasm-release | OK | 128 |
Exports:baConTreeContextTreefit_vlmcmetropolis_vlmcrvlmcSequence
Dependencies:base64encBrobdingnagcachemclicpp11digestdplyrfarverfastmapgenericsggforceggplot2ggraphggrepelgluegraphlayoutsgridExtragtableigraphisobandjsonlitelabelinglatticelifecyclemagrittrMASSMatrixmemoisepillarpkgconfigpolyclipprogressrpurrrR6RColorBrewerRcppRcppArmadillorlangS7scalesstringistringrsystemfontstibbletidygraphtidyrtidyselecttweenrutf8vctrsviridisviridisLitewithr
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Simulated Sequence Data from a Variable Length Markov Chain (VLMC) | abc_data abc_list abc_vec |
| Bayesian Context Tree R6 Class | baConTree |
| ContextTree R6 Class | ContextTree |
| Fit a Variable Length Markov Chain (VLMC) via Context Algorithm | fit_vlmc |
| Metropolis-Hastings Posterior Sampling for Context Trees | metropolis_vlmc |
| Plot method for baConTree class | plot.baConTree |
| Plot method for ContextTree class | plot.ContextTree |
| Generate a sequence based on a Variable Length Markov Chain (VLMC) | rvlmc |
| Sequence Class | Sequence |
| TreeNode Class | TreeNode |
